Compound reference

IGF-1 LR3: sequence

IGF-1 LR3 (Long R3 IGF-I) is a recombinant IGF-I analogue (N-terminally extended [Arg3]-IGF-I, 83 residues).

For Laboratory Research Use Only. Not For Human Consumption.

Chemical data

Name

IGF-1 LR3

Synonyms

Long R3 IGF-I · LR3IGF-I · Long-[Arg3]-IGF-I

CAS number

Not assignedNo CAS number is assigned to Long R3 IGF-I.

Residues

83

Class

Recombinant IGF-I analogue (N-terminally extended [Arg3]-IGF-I, 83 residues)

Form supplied

Lyophilized powder

Purity specification

≥98% (HPLC)

Storage

Store lyophilized at -20°C; protect from light

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

13-residue N-terminal extension (Met + porcine GH residues 1-10, then Val-Asn) followed by human IGF-I(1-70) with Glu3->Arg (Arg16 in this numbering). Three disulfides of the IGF-I domain: IGF-I Cys6-Cys48, Cys18-Cys61, Cys47-Cys52 (= Cys19-Cys61, Cys31-Cys74, Cys60-Cys65 in the 83-residue numbering). Free C-terminal acid.

References

Publications characterising this compound. Neupeptides makes no representation as to the findings, methods or applicability of the work below. The list is bibliographic and is not a claim about any product.

1. Francis GL, et al. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. J Mol Endocrinol. 1992. PMID 1378742 · doi:10.1677/jme.0.0080213
2. King R, et al. Production and characterization of recombinant insulin-like growth factor-I (IGF-I) and potent analogues of IGF-I, with Gly or Arg substituted for Glu3, following their expression in Escherichia coli as fusion proteins. J Mol Endocrinol. 1992. PMID 1311930 · doi:10.1677/jme.0.0080029
3. Laajoki LG, et al. Secondary structure determination of 15N-labelled human Long-[Arg-3]-insulin-like growth factor 1 by multidimensional NMR spectroscopy. FEBS Lett. 1997. PMID 9450557 · doi:10.1016/s0014-5793(97)01496-8